top of page
Subscribe to our Newsletter Today!
Buy GLP-1 Research Peptides
Browse GLP-1 research peptides including Semaglutide, Tirzepatide, and Retatrutide. High-quality GLP-1 analogs for laboratory studies, with clear information, fast processing, and trusted sourcing through PurePeptides.
🟢Thymosin Beta-4 | 5mg 🏆Amber
$84.99
In stock
1
Save this product for later
🟢Thymosin Beta-4 | 5mg 🏆Amber
Product Details

Thymosin Beta-4
Amber Vial| Unit Size | 5 mg |
| Unit Quantity | 1 Amber Vial |
| Molecular Formula | C₁₉₉H₃₂₄N₅₆O₆₁S |
| Molecular Weight | 4963 Da |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Appearance | White Powder |
| Peptide Purity | >99.1% |
| Solubility | Soluble in bacteriostatic water |
thymosin beta 4, thymosin beta 4 benefits, thymosin beta 4 dosage, thymosin beta 4 side effects, thymosin beta 4 supplement, thymosin beta 4 buy, does thymosin beta 4 cause cancer, tb 4 peptide, tb-4 peptide, tb 4 benefits, peptide tb 4, tb-4 research peptide, thymosin beta 4 5mg amber edition, tb4 non-fragment peptide
Powered by Lightspeed
Display prices in:
USD
bottom of page