top of page

Subscribe to our Newsletter Today!

Buy GLP-1 Research Peptides

Browse GLP-1 research peptides including Semaglutide, Tirzepatide, and Retatrutide. High-quality GLP-1 analogs for laboratory studies, with clear information, fast processing, and trusted sourcing through PurePeptides.

🟢Thymosin Beta 4 | 10 mg 🏆Amber

$139.99
In stock
1
Save this product for later
Share this product with your friends
🟢Thymosin Beta 4 | 10 mg 🏆Amber
Product Details

Thymosin Beta-4

Amber Vial
Unit Size 10 mg
Unit Quantity 1 Amber Vial
Molecular Formula C₁₉₉H₃₂₄N₅₆O₆₁S
Molecular Weight 4963 Da
Sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Appearance White Powder
Peptide Purity >99.1%
Solubility Soluble in bacteriostatic water
thymosin beta 4, thymosin beta 4 benefits, thymosin beta 4 dosage, thymosin beta 4 side effects, thymosin beta 4 supplement, thymosin beta 4 buy, does thymosin beta 4 cause cancer, tb 4 peptide, tb-4 peptide, tb 4 benefits, peptide tb 4, tb-4 research peptide, thymosin beta 4 10mg amber edition, tb4 peptide for research
bottom of page