top of page
Subscribe to our Newsletter Today!
Buy GLP-1 Research Peptides
Browse GLP-1 research peptides including Semaglutide, Tirzepatide, and Retatrutide. High-quality GLP-1 analogs for laboratory studies, with clear information, fast processing, and trusted sourcing through PurePeptides.
🟢TB-4 / BPC-157 | 5/5mg Blend 🏆 Amber Edition
$139.99
Low Stock
In stock
1
Save this product for later
🟢TB-4 / BPC-157 | 5/5mg Blend 🏆 Amber Edition
Product Details
Brand:
MicroPharma.us

Thymosin Beta 4 / BPC-157 Blend
Amber Vial Blend| Compound | Thymosin Beta 4 | BPC-157 |
| Unit Size | 5 mg | 5 mg |
| Unit Quantity | ½ Amber Vial | ½ Amber Vial |
| Molecular Formula | C₁₉₉H₃₂₄N₅₆O₆₁S | C62H98N16O22 |
| Molecular Weight | 4963 Da | 1419.5 |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val |
| Appearance | White Powder | White Powder |
| Peptide Purity | >99.1% | >99.1% |
| Solubility | Soluble in bacteriostatic water | Soluble in bacteriostatic water |
thymosin beta 4, thymosin beta 4 benefits, thymosin beta 4 dosage, thymosin beta 4 side effects, thymosin beta 4 supplement, thymosin beta 4 buy, does thymosin beta 4 cause cancer, tb 4 peptide, tb-4 peptide, tb 4 benefits, peptide tb 4, tb-4 research peptide, tb-4 bpc-157 blend, tb4 bpc157 5mg 5mg, thymosin beta 4 bpc blend, tb4 non-fragment peptide
You May Also Like
Best Seller
🟢BPC-157 | 10mg 🏆 Amber Edition
🟢BPC-157 | 10mg 🏆 Amber Edition
was
$99.99
Save
33%
$66.99
Out of stock
New
🟢Thymosin Alpha-1 | 10mg 🏆 Amber Edition
🟢Thymosin Alpha-1 | 10mg 🏆 Amber Edition
$129.99
Out of stock
Powered by Lightspeed
Display prices in:
USD
bottom of page