top of page
Subscribe to our Newsletter Today!
Buy GLP-1 Research Peptides
Browse GLP-1 research peptides including Semaglutide, Tirzepatide, and Retatrutide. High-quality GLP-1 analogs for laboratory studies, with clear information, fast processing, and trusted sourcing through PurePeptides.
🟠LL-37 | 5mg 🏆 Amber Edition
Product Details
Brand:
MicroPharma.us
LL-37
Amber Vial| Unit Size | 10 mg |
| Unit Quantity | 1 Amber Vial |
| Molecular Formula | C215H350N62O71 |
| Molecular Weight | 4493.11 g/mol |
| Sequence | [LL-37, 37 aa] |
| Appearance | White Powder |
| Peptide Purity | >99.1% |
| Solubility | Soluble in bacteriostatic water |
The LL-37 5mg peptide is a cationic host-defense research peptide used in studies examining antimicrobial signaling, innate immune response, epithelial barrier behavior, inflammation-modulating mechanisms, and wound-healing pathways; related scientific focus areas include antimicrobial peptide interactions, cathelicidin signaling models, LL-37 dosage research, and comparative host-defense peptide assays.
bottom of page